Antibodies

Jump to Filters
View as table Download
TMEM116 Rabbit Polyclonal Antibody
TA330781

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TMEM116 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMEM116 antibody is: synthetic peptide directed towards the C-terminal region of Human TMEM116. Synthetic peptide located within the following region: QRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGL