Antibodies

Jump to Filters
View as table Download
TMPRSS11F Rabbit Polyclonal Antibody
TA371569

USD 380.00

4 Weeks

TMPRSS11F rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMPRSS11F
TMPRSS11F Rabbit Polyclonal Antibody
TA330795

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMPRSS11F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPRSS11F antibody is: synthetic peptide directed towards the C-terminal region of Human TMPRSS11F. Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF
TMPRSS11F Rabbit Polyclonal Antibody
TA351823

USD 345.00

In Stock

Rabbit Polyclonal Anti-TMPRSS11F Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMPRSS11F