Anti-TNNI2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNNI2 antibody was raised against synthetic peptide |
Anti-TNNI2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNNI2 antibody was raised against synthetic peptide |
USD 450.00
2 Weeks
Troponin I fast skeletal muscle (TNNI2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TNNI2 |
Rabbit anti-TNNI2 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-TNNI2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNNI2 antibody: synthetic peptide directed towards the N terminal of human TNNI2. Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) TNNI2 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Troponin I2 (TNNI2) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I2 (Troponin I2 (TNNI2)) (NP_003273.1). |
Modifications | Unmodified |
USD 379.00
In Stock
TNNI2 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNNI2 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNNI2 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
TNNI2 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |