Antibodies

Jump to Filters
View as table Download
TRAPPC3 Rabbit Polyclonal Antibody
TA315364

USD 345.00

In Stock

Rabbit polyclonal anti-TRAPPC3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TRAPPC3.
TRAPPC3 (N-term) Rabbit Polyclonal Antibody
AP54354PU-N

USD 450.00

2 Weeks

TRAPPC3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human TRAPPC3
TRAPPC3 Rabbit Polyclonal Antibody
TA331302

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRAPPC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRAPPC3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAPPC3. Synthetic peptide located within the following region: TQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADV
TRAPPC3 Rabbit Polyclonal Antibody
TA382788

USD 220.00

3 Weeks

TRAPPC3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TRAPPC3 (NP_055223.1).
Modifications Unmodified