Rabbit Polyclonal Anti-TRIM41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the N terminal of human TRIM41. Synthetic peptide located within the following region: MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGG |
Rabbit Polyclonal Anti-TRIM41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the C terminal of human TRIM41. Synthetic peptide located within the following region: RGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQ |
Rabbit Polyclonal Anti-TRIM41 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM41 Antibody: synthetic peptide directed towards the C terminal of human TRIM41. Synthetic peptide located within the following region: AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLG |
Rabbit Polyclonal Anti-KL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KL antibody: synthetic peptide directed towards the n terminal of human KL. Synthetic peptide located within the following region: FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP |
Rabbit Polyclonal Anti-TRIM41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the middle region of human TRIM41. Synthetic peptide located within the following region: RFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQPSLTYYVCPTDRPEFSF |
TRIM41 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRI41 |
TRIM41 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 421-630 of human TRIM41 (NP_291027.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
