Rabbit Polyclonal Anti-TRIM59 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM59 antibody: synthetic peptide directed towards the middle region of human TRIM59. Synthetic peptide located within the following region: LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV |
Goat Anti-MURF2 / TRIM55 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HIFSFSWLNSLNE, from the C Terminus of the protein sequence according to NP_908973.1; NP_908974.1; NP_908975.1. |
Rabbit Polyclonal Anti-TRIM55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM55 antibody: synthetic peptide directed towards the N terminal of human TRIM55. Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ |
Rabbit Polyclonal Anti-TRIM55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM55 antibody: synthetic peptide directed towards the N terminal of human TRIM55. Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ |
Rabbit Polyclonal Anti-TRIM55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM55 Antibody: synthetic peptide directed towards the middle region of human TRIM55. Synthetic peptide located within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ |
TRIM55 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TRI55 |
TRIM55 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 183-452 of human TRIM55 (NP_908974.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
