Rabbit Polyclonal Anti-TRMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRMT1 Antibody: synthetic peptide directed towards the N terminal of human TRMT1. Synthetic peptide located within the following region: AMENGTGPYGEERPREVQETTVTEGAAKIAFPSANEVFYNPVQEFNRDLT |
Rabbit Polyclonal Anti-TRMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FLJ20244 Antibody: synthetic peptide directed towards the middle region of human FLJ20244. Synthetic peptide located within the following region: NPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRS |
TRMT1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRMT1 |
TRMT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 460-659 of human TRMT1 (NP_060192.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
