Antibodies

Jump to Filters
View as table Download
TTC16 (N-term) Rabbit Polyclonal Antibody
AP54393PU-N

USD 450.00

2 Weeks

TTC16 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TTC16
TTC16 Rabbit Polyclonal Antibody
TA329582

USD 375.00

5 Days

Rabbit polyclonal anti-TTC16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TTC16 antibody: synthetic peptide directed towards the C terminal of human TTC16. Synthetic peptide located within the following region: RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS
TTC16 Rabbit Polyclonal Antibody
TA366066

USD 380.00

4 Weeks

TTC16 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TTC16
TTC16 Rabbit Polyclonal Antibody
TA370419

USD 380.00

4 Weeks

TTC16 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TTC16