Rabbit Polyclonal Anti-TBX10 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tbx10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVDPRKDSARYAQENFKSFVFTETQFTAVTAYQNHRITQLKIASNPFAKG |
Rabbit Polyclonal Anti-TBX10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX10 antibody: synthetic peptide directed towards the middle region of human TBX10. Synthetic peptide located within the following region: ESDLDSWPVAPRPLLSVPARSHSSLSPCVLKGATDREKDPNKASASTSKT |
Rabbit Polyclonal Anti-TBX10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX10 Antibody: A synthesized peptide derived from human TBX10 |
Rabbit polyclonal anti-TBX10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TBX10. |
Rabbit Polyclonal Anti-TBX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX10 antibody: synthetic peptide directed towards the N terminal of human TBX10. Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA |
Rabbit Polyclonal Anti-Tbx10 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tbx10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNN |
Germany
Japan
United Kingdom
China
