Antibodies

Jump to Filters
View as table Download
TEDC1 Rabbit Polyclonal Antibody
TA331399

USD 375.00

5 Days

Rabbit polyclonal Anti-C14orf80 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C14orf80 antibody: synthetic peptide directed towards the n terminal of human C14orf80. Synthetic peptide located within the following region: MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ
TEDC1 Rabbit Polyclonal Antibody
TA369858

USD 380.00

4 Weeks

TEDC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TEDC1