Rabbit Polyclonal Anti-TESC Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TESC antibody is: synthetic peptide directed towards the C-terminal region of Human TESC. Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME |
Rabbit Polyclonal Anti-TESC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TESC antibody is: synthetic peptide directed towards the N-terminal region of Human TESC. Synthetic peptide located within the following region: SEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNP |
TESC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TESC |
TESC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). |
| Modifications | Unmodified |
TESC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
