Rabbit Polyclonal Anti-TMOD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMOD3 antibody: synthetic peptide directed towards the N terminal of human TMOD3. Synthetic peptide located within the following region: LDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLLSYLEKEALEHKDRED |
Rabbit Polyclonal Anti-TMOD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMOD3 antibody: synthetic peptide directed towards the middle region of human TMOD3. Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT |
TMOD3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TMOD3 |
TMOD3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMOD3 |
TMOD3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-352 of human TMOD3 (NP_055362.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
