Antibodies

View as table Download

Anti-TNNI2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TNNI2 antibody was raised against synthetic peptide

Troponin I fast skeletal muscle (TNNI2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TNNI2

Rabbit anti-TNNI2 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit Polyclonal Anti-TNNI2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNI2 antibody: synthetic peptide directed towards the N terminal of human TNNI2. Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL

Carrier-free (BSA/glycerol-free) TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Troponin I2 (TNNI2) Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I2 (Troponin I2 (TNNI2)) (NP_003273.1).
Modifications Unmodified

TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TNNI2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP