TRIB2 goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus |
Immunogen | Synthetic peptide from human TRIB2 |
TRIB2 goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus |
Immunogen | Synthetic peptide from human TRIB2 |
Rabbit Polyclonal Anti-TRIB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRIB2 Antibody: synthetic peptide directed towards the middle region of human TRIB2. Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE |
Carrier-free (BSA/glycerol-free) TRIB2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TRIB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
TRIB2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
TRIB2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIB2 (NP_067675.1). |
Modifications | Unmodified |
TRIB2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
TRIB2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
TRIB2 mouse monoclonal antibody, clone OTI8D11 (formerly 8D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |