Rabbit Polyclonal Anti-UGCGL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGCGL2 antibody: synthetic peptide directed towards the N terminal of human UGCGL2. Synthetic peptide located within the following region: KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR |
Rabbit Polyclonal Anti-UGCGL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGCGL2 antibody: synthetic peptide directed towards the middle region of human UGCGL2. Synthetic peptide located within the following region: LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL |
Germany
Japan
United Kingdom
China
