Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-USF2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USF2 antibody: synthetic peptide directed towards the middle region of human USF2. Synthetic peptide located within the following region: AGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPA |
Rabbit Polyclonal Anti-USF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USF2 Antibody: A synthesized peptide derived from human USF2 |
Rabbit polyclonal USF2 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This USF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 218-246 amino acids from the Central region of human USF2. |
Rabbit Polyclonal Anti-USF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USF2 Antibody: synthetic peptide directed towards the N terminal of human USF2. Synthetic peptide located within the following region: GDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDG |
USF2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USF2 |
USF2 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse USF2 |
USF2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human USF2 (NP_003358.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- USF2