Rabbit Polyclonal Anti-USP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP3 antibody: synthetic peptide directed towards the middle region of human USP3. Synthetic peptide located within the following region: IEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCAL |
Rabbit Polyclonal Anti-USP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP3 antibody: synthetic peptide directed towards the N terminal of human USP3. Synthetic peptide located within the following region: GRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCD |
USP3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human USP3 |
USP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 321-520 of human USP3 (NP_006528.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China