Antibodies

Jump to Filters
View as table Download
VKORC1 Rabbit Polyclonal Antibody
TA320006

USD 430.00

5 Days

Rabbit Polyclonal VKORC1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen VKORC1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human VKORC1.
VKORC1 Rabbit Polyclonal Antibody
TA343292

USD 375.00

5 Days

Rabbit Polyclonal Anti-VKORC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VKORC1 antibody is: synthetic peptide directed towards the N-terminal region of VKORC1. Synthetic peptide located within the following region: LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV