Antibodies

View as table Download

Rabbit Polyclonal Anti-VSX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the N terminal of human VSX1. Synthetic peptide located within the following region: MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPG

Rabbit Polyclonal Anti-VSX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: VSPENGLEDVAIDLSSSARQETKKVHPGAGAQGGSNSTALEGPQPGKVGA

VSX1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 124-154 amino acids from the Central region of human VSX1

Rabbit Polyclonal Anti-Vsx1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vsx1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vsx1. Synthetic peptide located within the following region: TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV

Rabbit Polyclonal Anti-Vsx1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Vsx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RSRSRALAPGCPPTGSRLRSFAINDLLGLEADLPTPAEPGLRSNSGDPAE

Rabbit Polyclonal Anti-VSX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK

Rabbit Polyclonal Anti-VSX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: FLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASP

VSX1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human VSX1

VSX1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human VSX1

VSX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human VSX1 (NP_055403.2).
Modifications Unmodified