Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-FLJ20674 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLJ20674 antibody: synthetic peptide directed towards the N terminal of human FLJ20674. Synthetic peptide located within the following region: LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS |
Rabbit Polyclonal Anti-VSIG10 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human VSIG10 |
VSIG10 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human VSIG10 |
Active filters
Target Symbol
- VSIG10