Antibodies

Jump to Filters
View as table Download
VTA1 Rabbit Polyclonal Antibody
TA345019

USD 475.00

5 Days

Rabbit Polyclonal Anti-VTA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VTA1 antibody: synthetic peptide directed towards the N terminal of human VTA1. Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
VTA1 Rabbit Polyclonal Antibody
TA308412

USD 415.00

5 Days

Rabbit Polyclonal antibody to VTA1 (Vps20-associated 1 homolog (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 276 of VTA1 (Uniprot ID#Q9NP79)
VTA1 Rabbit Polyclonal Antibody
TA366477

USD 380.00

4 Weeks

VTA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VTA1
VTA1 Rabbit Polyclonal Antibody
TA370826

USD 380.00

4 Weeks

VTA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VTA1