Rabbit Polyclonal Anti-YTHDF1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YTHDF1 Antibody: A synthesized peptide derived from human YTHDF1 |
Rabbit Polyclonal Anti-YTHDF1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YTHDF1 Antibody: A synthesized peptide derived from human YTHDF1 |
YTHDF1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human YTHDF1 |
Rabbit Polyclonal Anti-YTHDF1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YTHDF1 antibody: synthetic peptide directed towards the middle region of human YTHDF1. Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA |
Rabbit Polyclonal Anti-YTHDF1 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ythdf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ythdf1. Synthetic peptide located within the following region: PAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDTLNK |
Rabbit polyclonal anti-YTHDF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human YTHDF1. |
YTHDF1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human YTHDF1 |
YTHDF1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human YTHDF1. |
Modifications | Unmodified |
YTHDF1 Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Hamster, Human |
Conjugation | Unconjugated |