Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-YTHDF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YTHDF1 Antibody: A synthesized peptide derived from human YTHDF1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-YTHDF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YTHDF1 antibody: synthetic peptide directed towards the middle region of human YTHDF1. Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA |
Rabbit Polyclonal Anti-YTHDF1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ythdf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ythdf1. Synthetic peptide located within the following region: PAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDTLNK |
Rabbit polyclonal anti-YTHDF1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human YTHDF1. |
YTHDF1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human YTHDF1. |
| Modifications | Unmodified |
YTHDF1 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- YTHDF1