Antibodies

Jump to Filters
View as table Download
ZNF295 (ZBTB21) Rabbit Polyclonal Antibody
TA331129

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF295 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF295 antibody: synthetic peptide directed towards the N terminal of human ZNF295. Synthetic peptide located within the following region: DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYI
ZNF295 (ZBTB21) Rabbit Polyclonal Antibody
TA383435

USD 220.00

3 Weeks

ZBTB21 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ZBTB21 (NP_065778.3).
Modifications Unmodified