Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-ZGPAT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the N terminal of human ZGPAT. Synthetic peptide located within the following region: DEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTE |
Rabbit Polyclonal anti-ZGPAT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the C terminal of human ZGPAT. Synthetic peptide located within the following region: AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF |
Rabbit Polyclonal anti-ZGPAT antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the middle region of human ZGPAT. Synthetic peptide located within the following region: LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS |
ZGPAT rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZGPAT |
ZGPAT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 212-511 of human ZGPAT (NP_852150.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ZGPAT