Rabbit Polyclonal ZMPSTE24 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Primate, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal portion of the human ZMPSTE24 protein sequence (between residues 1-100). [Swiss-Prot O75844] |
Rabbit Polyclonal Anti-ZMPSTE24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMPSTE24 antibody: synthetic peptide directed towards the N terminal of human ZMPSTE24. Synthetic peptide located within the following region: LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL |
Goat Polyclonal Antibody against ZMPSTE24
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERLQALKTMKQH, from the C Terminus of the protein sequence according to NP_005848.2. |
ZMPSTE24 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZMPSTE24 (NP_005848.2). |
Germany
Japan
United Kingdom
China