Antibodies

Jump to Filters
View as table Download
ZNF136 (N-term) Rabbit Polyclonal Antibody
AP54670PU-N

USD 450.00

2 Weeks

ZNF136 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 103-133 amino acids from the N-terminal region of human ZNF136
ZNF136 Rabbit Polyclonal Antibody
TA339079

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF136 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF136 antibody: synthetic peptide directed towards the N terminal of human ZNF136. Synthetic peptide located within the following region: TKDGSQRGGIFSQFANQNLSKKIPGVKLCESIVYGEVSMGQSSLNRHIKD