Rabbit Polyclonal Anti-ZNF21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF21 Antibody: synthetic peptide directed towards the middle region of human ZNF21. Synthetic peptide located within the following region: RTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKS |
Rabbit Polyclonal Anti-ZNF182 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF182 antibody: synthetic peptide directed towards the middle region of human ZNF182. Synthetic peptide located within the following region: CGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHAGKK |
ZNF182 Antibody - C-terminal
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF182 antibody is: synthetic peptide directed towards the C-terminal of Human ZN182 |
ZNF182 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-210 of human ZNF182 (NP_001171570.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
