Germany
Japan
United Kingdom
China
ZNF263 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 317-346 amino acids from the Central region of human ZNF263 |
Antibodies
View as table Download
Rabbit Polyclonal anti-ZNF263 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF263 antibody: synthetic peptide directed towards the N terminal of human ZNF263. Synthetic peptide located within the following region: PLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQRDPQAVKERALSA |
Rabbit Polyclonal Anti-ZNF263 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF263 antibody: synthetic peptide directed towards the middle region of human ZNF263. Synthetic peptide located within the following region: CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT |
ZNF263 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF263 |
ZNF263 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human ZNF263 (NP_005732.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ZNF263