Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF280A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF280A antibody: synthetic peptide directed towards the C terminal of human ZNF280A. Synthetic peptide located within the following region: WRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQLQGFPRETKV

Carrier-free (BSA/glycerol-free) ZNF280A mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF280A mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ZNF280A mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

ZNF280A mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

ZNF280A mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated