Rabbit Polyclonal Anti-ZNF440 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF440 antibody: synthetic peptide directed towards the N terminal of human ZNF440. Synthetic peptide located within the following region: VNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR |
Rabbit Polyclonal Anti-ZNF440 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF440 antibody: synthetic peptide directed towards the C terminal of human ZNF440. Synthetic peptide located within the following region: PMSVSNDGKPSDLPHTFEYVVGHTMERSPMHVRNVGNPSDLPRTFEFMKG |
Rabbit Polyclonal Anti-ZNF440 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF440 antibody: synthetic peptide directed towards the middle region of human ZNF440. Synthetic peptide located within the following region: ECGKAFTCPRYVRIHERTHSRKNLYECKQCGKALSSLTSFQTHVRLHSGE |
Germany
Japan
United Kingdom
China