Rabbit Polyclonal Anti-ZNF668 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF668 antibody: synthetic peptide directed towards the C terminal of human ZNF668. Synthetic peptide located within the following region: KSFSDRAGLRKHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPMGT |
Rabbit polyclonal anti-ZNF668 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF668. |
Rabbit Polyclonal Anti-ZNF668 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF668 Antibody: synthetic peptide directed towards the N terminal of human ZNF668. Synthetic peptide located within the following region: ARSPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGPADCSEEVAEVK |
Germany
Japan
United Kingdom
China