Rabbit Polyclonal Anti-OAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAS1 antibody: synthetic peptide directed towards the N terminal of human OAS1. Synthetic peptide located within the following region: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS |
Rabbit Polyclonal Anti-ZNF671 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF671 antibody: synthetic peptide directed towards the N terminal of human ZNF671. Synthetic peptide located within the following region: YHGGKARQKPYLCGACGKQFWFSTDFDQHQNQPNGGKLFPRKEGRDSVKS |
Rabbit Polyclonal Anti-ZNF671 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF671 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF671. Synthetic peptide located within the following region: GKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL |
Germany
Japan
United Kingdom
China
