Rabbit Polyclonal Anti-ZNF672 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF672 antibody: synthetic peptide directed towards the middle region of human ZNF672. Synthetic peptide located within the following region: CFSHSRSLSQHQRAHTRARTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS |
ZNF672 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF672 |
ZNF672 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 347-377 amino acids from the C-terminal region of human ZNF672 |
Rabbit Polyclonal Anti-ZNF672 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF672 Antibody: synthetic peptide directed towards the middle region of human ZNF672. Synthetic peptide located within the following region: NHAGHKPHKCPECSKAFSVASKLALHRKTHLGERPAECAECGKCFSHSRS |
ZNF672 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
