Rabbit Polyclonal Anti-ZNF70 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the C terminal of human ZNF70. Synthetic peptide located within the following region: GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL |
Rabbit Polyclonal Anti-ZNF70 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the N terminal of human ZNF70. Synthetic peptide located within the following region: MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKE |
Rabbit Polyclonal Anti-ZNF70 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the N terminal of human ZNF70. Synthetic peptide located within the following region: ETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPY |
ZNF70 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF70 (NP_068735.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
