Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ZNF76 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF76. |
Antibodies
View as table Download
Rabbit polyclonal ZNF76 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZNF76 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 388-415 amino acids from the C-terminal region of human ZNF76. |
Rabbit Polyclonal Anti-ZNF76 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF76 Antibody: synthetic peptide directed towards the middle region of human ZNF76. Synthetic peptide located within the following region: MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK |
Rabbit Polyclonal Anti-ZNF76 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the N terminal of human ZNF76. Synthetic peptide located within the following region: LSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQ |
Active filters
Target Symbol
- ZNF76