Antibodies

View as table Download

Rabbit Polyclonal Anti-ZBTB26 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB26 antibody: synthetic peptide directed towards the N terminal of human ZBTB26. Synthetic peptide located within the following region: MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIV

Rabbit Polyclonal Anti-ZBTB26 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB26 antibody: synthetic peptide directed towards the C terminal of human ZBTB26. Synthetic peptide located within the following region: VFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGC

Rabbit Polyclonal Anti-ZBTB26 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB26 antibody: synthetic peptide directed towards the middle region of human ZBTB26. Synthetic peptide located within the following region: QIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVS