ZBTB3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZBTB3 |
ZBTB3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZBTB3 |
Rabbit Polyclonal Anti-ZBTB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB3 antibody: synthetic peptide directed towards the middle region of human ZBTB3. Synthetic peptide located within the following region: EDLAKRSKPDPEVGPLLGVQPLPGSPTADRQSSSGGGPPKDFVLAPKTNI |
Rabbit Polyclonal Anti-ZBTB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB3 antibody: synthetic peptide directed towards the N terminal of human ZBTB3. Synthetic peptide located within the following region: MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGT |
Rabbit Polyclonal ZBTB3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | ZBTB3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human ZBTB3. |
ZBTB3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBTB3 |
ZBTB3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZBTB3 |