Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ZCCHC17 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZCCHC17. |
Rabbit Polyclonal Anti-ZCCHC17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZCCHC17 antibody: synthetic peptide directed towards the C terminal of human ZCCHC17. Synthetic peptide located within the following region: PSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKK |
Rabbit Polyclonal Anti-ZCCHC17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZCCHC17 antibody: synthetic peptide directed towards the middle region of human ZCCHC17. Synthetic peptide located within the following region: CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH |
Carrier-free (BSA/glycerol-free) ZCCHC17 mouse monoclonal antibody,clone OTI9A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZCCHC17 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZCCHC17 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human ZCCHC17 (NP_057589.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ZCCHC17 mouse monoclonal antibody,clone OTI9A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZCCHC17 mouse monoclonal antibody,clone OTI9A7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZCCHC17 mouse monoclonal antibody,clone OTI9A7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZCCHC17 mouse monoclonal antibody,clone OTI9A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZCCHC17 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZCCHC17 mouse monoclonal antibody,clone OTI7F9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZCCHC17 mouse monoclonal antibody,clone OTI7F9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZCCHC17 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ZCCHC17