Rabbit Polyclonal ZFX Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZFX antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ZFX. |
Rabbit Polyclonal ZFX Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZFX antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ZFX. |
Rabbit Polyclonal Anti-ZFX Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZFX Antibody: synthetic peptide directed towards the middle region of human ZFX. Synthetic peptide located within the following region: KVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYM |
Rabbit Polyclonal Anti-ZFX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZFX antibody: synthetic peptide directed towards the N terminal of human ZFX. Synthetic peptide located within the following region: MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT |
Rabbit Polyclonal Anti-ZFX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZFX antibody is: synthetic peptide directed towards the C-terminal region of Human ZFX. Synthetic peptide located within the following region: TTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP |
ZFX Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-380 of human ZFX (NP_003401.2). |
Modifications | Unmodified |