Mouse Gm5176 (BC054110) AAV Particle

CAT#: MR200022A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, EG382421 (Myc-DDK-tagged) - Mouse predicted gene, EG382421 (cDNA clone MGC:60992 IMAGE:30017181), 250ul, >10^13 TU/mL



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "Gm5176"

Specifications

Product Data
Tag Myc-DDK
Symbol Gm5176
Synonyms EG382421
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR200022 representing BC054110
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAACAACACTGCAGTGGATAACAAGCAGCCCCATAAGAAGAAAGCTGCCGAGCAGAAGGAGGAGT
ACGAGAAGGATATTGCTGCCTACAGAGCTAAAGGAAAACCTGATGCAGCGAAAAAGGGGGTGGTCAAGGC
TGAAAAGAGCAAGAAAAAAGGAAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200022 representing BC054110
Red=Cloning site Green=Tags(s)

MWNNTAVDNKQPHKKKAAEQKEEYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKGR

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN BC054110
ORF Size 165 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq BC054110.1
RefSeq Size 1253 bp
RefSeq ORF 167 bp
Locus ID 382421
Cytogenetics 10 D1
MW 6.2 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.