Mouse Gng7 (NM_010319) AAV Particle

CAT#: MR227721A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, Gng7 (myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), gamma 7 (Gng7), transcript variant 2, 250ul, >10^13 TU/mL



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "Gng7"

Specifications

Product Data
Tag Myc-DDK
Symbol Gng7
Synonyms AI840417
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR227721 representing NM_010319
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTCAGGTACTAACAACGTCGCCCAGGCCCGGAAGCTGGTGGAGCAGCTGCGCATTGAAGCTGGGA
TCGAACGCATCAAGGTCTCCAAGGCCTCGTCAGACCTGATGGGCTACTGTGAGCAACATGCCCGCAACGA
TCCCTTGCTGGTTGGCGTGCCAGCCTCTGAGAATCCATTCAAAGACAAAAAGCCTTGCATAATTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227721 representing NM_010319
Red=Cloning site Green=Tags(s)

MMSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN NM_010319
ORF Size 204 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_010319.3
RefSeq Size 3362 bp
RefSeq ORF 210 bp
Locus ID 14708
Cytogenetics 10 39.72 cM
MW 7.5 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.