Mouse Wfdc15b (NM_001045554) AAV Particle

CAT#: MR227743A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, Wfdc15b (myc-DDK-tagged) - Mouse WAP four-disulfide core domain 15B (Wfdc15b), transcript variant 2, 250ul, >10^13 TU/mL



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "Wfdc15b"

Specifications

Product Data
Tag Myc-DDK
Symbol Wfdc15b
Synonyms 9230106L14Rik; SWAM1; Wfdc15
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR227743 representing NM_001045554
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTGCTTGGCCTCTCTCTACTCGCAGTGACCATTCTGCTTTGCTGTAACATGGCTCGACCTGAAA
TAAAGAAGAAGAACGTTTTTTCCAAACCTGGCTATTGCCCAGAGTATCGGGTTCCCTGCCCCTTTGTCCT
TATACCTAAATGCAGGCGTGATAAAGGCTGCAAGGACGCCCTGAAGTGTTGCTTCTTCTACTGCCAGATG
CGCTGTGTGGATCCATGGGAGAGCCCAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227743 representing NM_001045554
Red=Cloning site Green=Tags(s)

MKLLGLSLLAVTILLCCNMARPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQM
RCVDPWESPE

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN NM_001045554
ORF Size 240 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_001045554.1, NP_001039019.1
RefSeq Size 553 bp
RefSeq ORF 243 bp
Locus ID 192201
UniProt ID Q9JHY4
Cytogenetics 2 H3
MW 9.2 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.