Human ATP5F1E (NM_006886) AAV Particle

CAT#: RC210456A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, ATP5E (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (ATP5E), nuclear gene encoding mitochondrial protein, 250ul, >10^13 TU/mL



Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "ATP5F1E"

Specifications

Product Data
Tag Myc-DDK
Symbol ATP5F1E
Synonyms ATP5E; ATPE; MC5DN3
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>RC210456 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGCCTACTGGAGACAGGCTGGACTCAGCTACATCCGATACTCCCAGATCTGTGCAAAAGCAGTGA
GAGATGCACTGAAGACAGAATTCAAAGCAAATGCTGAGAAGACTTCTGGCAGCAACGTAAAAATTGTGAA
AGTAAAGAAGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210456 protein sequence
Red=Cloning site Green=Tags(s)

MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE

myc-FLAG tag
Species Human
Serotype AAV-2
ACCN NM_006886
ORF Size 153 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_006886.2
RefSeq Size 449 bp
RefSeq ORF 156 bp
Locus ID 514
UniProt ID P56381
Cytogenetics 20q13.32
MW 5.8 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.