Whrn (NM_001008795) Mouse Tagged ORF Clone

CAT#: MG223636

  • TrueORF®

Whrn (GFP-tagged) - Mouse whirlin (Whrn) transcript variant 6, (10ug)


  "NM_001008795" in other vectors (4)

Reconstitution Protocol

USD 540.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Whrn"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Whrn
Synonyms 1110035G07Rik; AW122018; AW742671; bM340H1.8; C430046P22Rik; mKIAA1526; whirlinNT1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG223636 representing NM_001008795
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGCACAGCTGGACGGCCTGTCGGTGAGCTCGTCCTCCACCGGCTCGCTGGGCTCGGCGGCGGCGG
CGGCGGGCGGCGGCGGGGGCGCGGGGTTGCGGCTGCTGTCTGCCAACGTGCGCCAGCTGCACCAAGCGCT
CACGGCGCTGCTGAGCGAGCCCGAGCGGGAGCAGTTCACTCACTGCCTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG223636 representing NM_001008795
Red=Cloning site Green=Tags(s)

MNAQLDGLSVSSSSTGSLGSAAAAAGGGGGAGLRLLSANVRQLHQALTALLSEPEREQFTHCL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001008795
ORF Size 190 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001008795.1, NP_001008795.1
RefSeq Size 2632 bp
RefSeq ORF 1398 bp
Locus ID 73750
Cytogenetics 4 C1
Gene Summary This gene encodes a protein required for elongation and actin polymerization in the hair cell stereocilia. The encoded protein is localized to the cytoplasm and co-localizes with the growing end of actin filaments. Mutations in this gene have been linked to deafness. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.