Crabp1 (BC065787) Mouse Tagged ORF Clone

CAT#: MR200075

  • TrueORF®

Crabp1 (Myc-DDK-tagged) - Mouse cellular retinoic acid binding protein I (cDNA clone MGC:73634 IMAGE:891192)


  "BC065787" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 310.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Crabp1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Crabp1
Synonyms CrabpI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200075 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAACTTCGCCGGTACCTGGAAGATGCGCAGCAGCGAGAATTTCGACGAGCTCCTCAAGGCGTTGG
GTGTGAACGCCATGCTGAGGAAGGTGGCCGTGGCGGCTGCGTCTAAGCCGCACGTGGAGATCCGCCAAGA
CGGGGATCAGTTCTACATCAAGACATCCACTACTGTGCGCACCACGGAGATCAACTTCAAGGTCGGAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200075 protein sequence
Red=Cloning site Green=Tags(s)

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC065787
ORF Size 210 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC065787, AAH65787
RefSeq Size 709
RefSeq ORF 212
Locus ID 12903
MW 7.8 kDa
Gene Summary Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.