Apln (NM_013912) Mouse Tagged ORF Clone

CAT#: MR200116

Apln (Myc-DDK-tagged) - Mouse apelin (Apln)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Apln
• Synonyms: 6030430G11Rik; Apel
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200116 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAATCTGAGGCTCTGCGTGCAGGCGCTGCTGCTGCTCTGGCTCTCCTTGACTGCAGTTTGTGGAGTGC
  CACTGATGTTGCCTCCAGATGGAACAGGACTAGAAGAAGGAAGCATGCGCTACCTGGTGAAGCCCAGAAC
  TTCGAGGACTGGACCAGGAGCCTGGCAGGGAGGCAGGAGGAAATTTCGCAGACAGCGCCCCCGGCTCTCC
  CATAAGGGCCCCATGCCTTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200116 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLS
  HKGPMPF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_013912
• ORF Size: 234 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_013912.1, NM_013912.2, NM_013912.3, NM_013912.4, NP_038940.1
• RefSeq Size: 3148 bp
• RefSeq ORF: 234 bp
• Locus ID: 30878
• MW: 8.7 kDa
• Gene Summary: This gene encodes the neuropeptide Apelin, an endogenous ligand of the G protein-coupled receptor APJ. This gene is highly expressed in the central nervous system and peripheral tissues and the encoded preproprotein undergoes proteolytic processing to generate mature peptides of different sizes that are secreted into the plasma. These peptides play important roles in a broad range of physiological processes such as cardiac contractility, blood pressure, blood vessel growth, appetite and drink behavior, and pituitary hormone secretion. Mice lacking the encoded protein develop progressive heart failure and exhibit a shorter bleeding time, prothrombotic profile and increased bone mass. [provided by RefSeq, Jul 2016]