Mrpl33 (BC027018) Mouse Tagged ORF Clone

CAT#: MR200388

Mrpl33 (Myc-DDK-tagged) - Mouse mitochondrial ribosomal protein L33 (cDNA clone MGC:35714 IMAGE:5365357)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Mrpl33
• Synonyms: 0610009M10Rik|L33mt|MRP-L33
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200388 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTGCTCTCCGCTGTCTCTTTTGCCAAGAGCAAGTCAAAAACTATCCTGGTGAAACTAGTGAGCCAAG
  CTGGGACAGGTTTCTCCTTCAACCACAAGAGAAGCCGACTCCGAGAGAAGCTGAGCCTTCTGCACTATGA
  TCCAATAGGCAACACCAGTAGCAACTATCAAACCCGAGTGAAGAATCTCTCAGCCTTGGAAATTTTCAAC
  TCTTGCCTCAGGCACCACAGAGCAAGGACAAGCCATGCCAGGCCCTATCTGAATTCCCTAGGATGGAAAC
  TGGGAATGGAAAACTATAGCTGCTTTGGAGAATTTATTATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200388 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIGNTSSNYQTRVKNLSALEIFN
  SCLRHHRARTSHARPYLNSLGWKLGMENYSCFGEFII
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC027018
• ORF Size: 321 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC027018, AAH27018
• RefSeq Size: 2191 bp
• RefSeq ORF: 323 bp
• Locus ID: 66845
• MW: 12.2 kDa