5330431N19Rik (BC027559) Mouse Tagged ORF Clone

CAT#: MR200449

  • TrueORF®

5330431N19Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 5330431N19 gene (cDNA clone MGC:41405 IMAGE:1493971)


  "BC027559" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 310.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "5330431N19Rik"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol 5330431N19Rik
Synonyms 5330431N19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200449 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGACTAGCTGGTTGGAGGTTTTGCGGTCGGCCGAGAAGACGGCACTGCTGCAGGATGGGAAGA
GGATGGTGCACTATTTGTTCCCAGACGGGAAGGAAATGGCAGAAGAATATGACGAGAAGACCAGTGAACT
CCTTGTGAGGAAGTGGCGTGTGAAAAATGCCCTGGGAGCCTTGGGCCAGTGGCAGCTTGAAGTGGGAGAG
CCAGTGCCCTCAGGAGCTGGGAGCCTGGGATCCGAGCTCATCAAAGAAACCCATCTTCATGCGCAAGGAC
ACCAAAACAAGTTTCCAGTGGCGGATTCGAAATCTCCCCTACCCGAAGGATGTGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200449 protein sequence
Red=Cloning site Green=Tags(s)

MAVTSWLEVLRSAEKTALLQDGKRMVHYLFPDGKEMAEEYDEKTSELLVRKWRVKNALGALGQWQLEVGE
PVPSGAGSLGSELIKETHLHAQGHQNKFPVADSKSPLPEGCV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC027559
ORF Size 336 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC027559, AAH27559
RefSeq Size 850 bp
RefSeq ORF 338 bp
Locus ID 226162
MW 12.4 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

Early changes in the hypothalamic region in prodromal Huntington disease revealed by MRI analysis
Soneson, Fontes, Zhou et al
Neurobiol Dis (2010) 40 (3), 531-43 DOI: 10.1016/j.nbd.2010.07.013
Evaluation of optimized b-value sampling schemas for diffusion kurtosis imaging with an application to stroke patient data
Yan, Zhou, Ying et al
Comput Med Imaging Graph (2013) 37 (4), 272-80 DOI: 10.1016/j.compmedimag.2013.04.007
Preparing for selective inhibition within frontostriatal loops
Smittenaar, Guitart-Masip, Lutti et al
J Neurosci (2013) 33 (46), 18087-97 DOI: 10.1523/JNEUROSCI.2167-13.2013
Showing 1-5 of 27 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.