Ndufa7 (NM_023202) Mouse Tagged ORF Clone

CAT#: MR200458

  • TrueORF®

Ndufa7 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a) (Ndufa7), nuclear gene encoding mitochondrial protein


  "NM_023202" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Ndufa7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ndufa7
Synonyms 14.5kDa; 2400007M02Rik; CI-B14.5a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200458 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCGCTACTCGCGTTATCCAAAAGCTGCGGAACTGGGCGTCTGGGCAAGACCTGCAGGCGAAGC
TACAGCTGCGCTACCAGGAGATCGCCAAGCGGACCCAGCCACCTCCGAAACTCCCCGTGGGCCCCAGTCA
CAAGCTGTCCAACAATTACTACTGTACTCGTGATGGCCGCCGGGAAGTTGTGCCTCCCTCAATCATCATG
TCCTCACAAAAGGCCCTGGTGTCAGGCAAGGCCGCCGAGAGTTCTGCAATGGCAGCCACTGAGAAGAAGG
CAGTGACACCTGCTCCTCCCATGAAGAGGTGGGAGCTGTCCAAGGACCAGCCATACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200458 protein sequence
Red=Cloning site Green=Tags(s)

MASATRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIM
SSQKALVSGKAAESSAMAATEKKAVTPAPPMKRWELSKDQPYL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_023202
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_023202.1, NM_023202.2, NM_023202.3, NM_023202.4, NP_075691.1
RefSeq Size 540
RefSeq ORF 342
Locus ID 66416
MW 12.6 kDa
Gene Summary This gene encodes a subunit of the NADH-ubiquinone oxidoreductase (complex I) enzyme, which is a large, multimeric protein. It is the first enzyme complex in the mitochondrial electron transport chain and catalyzes the transfer of electrons from NADH to the electron acceptor ubiquinone. The proton gradient created by electron transfer drives the conversion of ADP to ATP. Complex I has been biochemically separated into four fractions. The bovine ortholog of this protein has been reported to be part of the I-lambda fraction, which forms the extrinsic globular domain. In humans, deficiencies in complex I are associated with myopathies, encephalomyopathies, and neurodegenerative disorders. Pseudogenes of this gene are located on chromosomes 7 and 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.